PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10001741m
Common NameCARUB_v10001741mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MYB
Protein Properties Length: 264aa    MW: 29444.8 Da    PI: 7.1429
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10001741mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding27.38.3e-092874346
                     SS-HHHHHHHHHHHHHTTTT....-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGgg....tWktIartmgkgRtlkqcksrwqk 46
                      WT eE +++ +a + l  +    +W +Ia+ ++ g+t  +++ r+  
  Carubv10001741m 28 TWTVEENKRFEKALAFLDDKdnpeSWFKIAALIP-GKTVADVIQRYKE 74
                     5*****************99**************.**********975 PP

2Myb_DNA-binding47.63.8e-15144188347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT++E+ +++ + k++G+g+W+ Ia+ + ++Rt+ q+ s+ qky
  Carubv10001741m 144 PWTEDEHRRFLMGLKKYGKGDWRNIAKNFVTTRTPTQVASHAQKY 188
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512936.5692478IPR017884SANT domain
SMARTSM007171.7E-62578IPR001005SANT/Myb domain
CDDcd001671.70E-72875No hitNo description
SuperFamilySSF466896.75E-92883IPR009057Homeodomain-like
PfamPF002493.3E-72874IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.8E-13136191IPR009057Homeodomain-like
PROSITE profilePS5129421.468137193IPR017930Myb domain
SuperFamilySSF466892.94E-17139192IPR009057Homeodomain-like
TIGRFAMsTIGR015571.3E-18140192IPR006447Myb domain, plants
SMARTSM007171.1E-12141191IPR001005SANT/Myb domain
PfamPF002498.0E-13144188IPR001005SANT/Myb domain
CDDcd001675.52E-11144189No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 264 aa     Download sequence    Send to blast
MSSSSTMNRG GIDMFSPANT SWIFQEATWT VEENKRFEKA LAFLDDKDNP ESWFKIAALI  60
PGKTVADVIQ RYKELEDDVS DIEAGLIPIP GYRGDASSGA NCDYFFGLEN SGGYGYGYGY  120
DYAVGGKRSF RPPLPEKERK KGVPWTEDEH RRFLMGLKKY GKGDWRNIAK NFVTTRTPTQ  180
VASHAQKYFL RQLTDCKDKR RSSIHDITTV NIPDADAATT AATGVLSPTP TTSSFDVFHQ  240
PNPHHSFAFA SASSYYNAFP QWS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006288482.10.0hypothetical protein CARUB_v10001741mg
SwissprotQ8S9H75e-76DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLR0H8W80.0R0H8W8_9BRAS; Uncharacterized protein
STRINGfgenesh1_pg.C_scaffold_60000791e-145(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM148841619
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G01200.11e-124MYB family protein